RAG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP174190

Catalog No. NBP174190

Description

RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

• Antigen: RAG1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 119 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, ChIP Assay
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation (ChIP)
• Gene Accession No.: P15919
• Gene Symbols: RAG1
• Immunogen: Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5896
• Target Species: Mouse, Rat, Pig, Equine
• Isotype: IgG