Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RAG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP17419020UL
Description
RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
RAG1 | |
Polyclonal | |
Western Blot 1:100-1:2000, Chromatin Immunoprecipitation | |
P15919 | |
RAG1 | |
Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT. | |
Affinity Purified | |
RUO | |
5896 | |
Store at -20C. Avoid freeze-thaw cycles. |
ChIP Assay | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1 | |
Rabbit | |
119 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction