Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RAG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

$206.00 - $548.00

Specifications

Antigen	RAG1
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit
Regulatory Status	RUO

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17419020 View Documents View Product Certificates	Novus Biologicals NBP17419020UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP174190 View Documents View Product Certificates	Novus Biologicals NBP174190	100 μL	Each for $548.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RAG1 Polyclonal specifically detects RAG1 in Mouse samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

Antigen	RAG1
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	MGC43321, RAG-1, recombination activating gene 1, RING finger protein 74, RNF74recombination activating protein 1, V(D)J recombination-activating protein 1
Gene Symbols	RAG1
Isotype	IgG
Molecular Weight of Antigen	119 kDa

Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	P15919
Gene ID (Entrez)	5896
Immunogen	Synthetic peptides corresponding to the C terminal of Rag1. Immunizing peptide sequence IIERDGSIGAWASEGNESGNKLFRRFRKMNARQSKCYEMEDVLKHHWLYT.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RAG1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents