Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP192311

RAG1AP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP192311 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP192311 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP192311 Supplier Novus Biologicals Supplier No. NBP192311
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RAG1AP1 Polyclonal specifically detects RAG1AP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RAG1AP1
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias HsSWEET1RAG1-activating protein 1, probable sugar transporter RAG1AP1, RAG1AP1SWEET1, recombination activating gene 1 activating protein 1, RZPDo834D038D, SCPRP11-540D14.5, slv, solute carrier family 50 (sugar transporter), member 1, Solute carrier family 50 member 1, Stromal cell protein
Gene Symbols SLC50A1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RMTRSVDNVQFLPFLTTEVNNLGWLSYGALKGDG
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55974
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.