Learn More
Description
Specifications
Specifications
| Antigen | RALGPS1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | KIAA0351RalGEF 2, Ral GEF with PH domain and SH3 binding motif 1, Ral GEF with PH domain and SH3-binding motif 1, Ral guanine nucleotide exchange factor 2, Ral guanine nucleotide exchange factor RalGPS1A, RalA exchange factor RalGPS1, RALGEF2RALGPS1A, ras-specific guanine nucleotide-releasing factor RalGPS1 |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein RALGPS1 using the following amino acid sequence: NMMCQLSVVESKSATFPSEKARHLLDDSVLESRSPRRGLALTSSSAVTNGLSLGSSESSEFSEEMSSGLES |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
