RALGPS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158314

Catalog No. NBP158314

Description

RALGPS1 Polyclonal specifically detects RALGPS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RALGPS1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0351RalGEF 2, Ral GEF with PH domain and SH3 binding motif 1, Ral GEF with PH domain and SH3-binding motif 1, Ral guanine nucleotide exchange factor 2, Ral guanine nucleotide exchange factor RalGPS1A, RalA exchange factor RalGPS1, RALGEF2RALGPS1A, ras-specific guanine nucleotide-releasing factor RalGPS1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Chicken: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5JS13
• Gene Symbols: RALGPS1
• Immunogen: Synthetic peptides corresponding to RALGPS1(Ral GEF with PH domain and SH3 binding motif 1) The peptide sequence was selected from the middle region of RALGPS1. Peptide sequence AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9649
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.