Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RALGPS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RALGPS1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RALGPS1 Polyclonal specifically detects RALGPS1 in Human samples. It is validated for Western Blot.Specifications
RALGPS1 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
KIAA0351RalGEF 2, Ral GEF with PH domain and SH3 binding motif 1, Ral GEF with PH domain and SH3-binding motif 1, Ral guanine nucleotide exchange factor 2, Ral guanine nucleotide exchange factor RalGPS1A, RalA exchange factor RalGPS1, RALGEF2RALGPS1A, ras-specific guanine nucleotide-releasing factor RalGPS1 | |
RALGPS1 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q5JS13 | |
9649 | |
Synthetic peptides corresponding to RALGPS1(Ral GEF with PH domain and SH3 binding motif 1) The peptide sequence was selected from the middle region of RALGPS1. Peptide sequence AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title