Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RALGPS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	RALGPS1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP158314 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP158314	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RALGPS1 Polyclonal specifically detects RALGPS1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	RALGPS1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Gene Alias	KIAA0351RalGEF 2, Ral GEF with PH domain and SH3 binding motif 1, Ral GEF with PH domain and SH3-binding motif 1, Ral guanine nucleotide exchange factor 2, Ral guanine nucleotide exchange factor RalGPS1A, RalA exchange factor RalGPS1, RALGEF2RALGPS1A, ras-specific guanine nucleotide-releasing factor RalGPS1
Gene Symbols	RALGPS1
Isotype	IgG

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	Q5JS13
Gene ID (Entrez)	9649
Immunogen	Synthetic peptides corresponding to RALGPS1(Ral GEF with PH domain and SH3 binding motif 1) The peptide sequence was selected from the middle region of RALGPS1. Peptide sequence AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RALGPS1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents