RALY Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP21320125UL

Catalog No. NB438669

Description

RALY Polyclonal specifically detects RALY in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: RALY
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500, Knockdown Validated
• Gene Alias: Autoantigen p542, Heterogeneous nuclear ribonucleoprotein C-like 2, hnRNP associated with lethal yellow protein homolog, hnRNP core protein C-like 2, HNRPCL2MGC117312, P542hnRNP-associated with lethal yellow), RNA binding protein (autoantigenic, hnRNP-associated with lethal yellow), RNA binding protein, autoantigenic (hnRNP-associated with lethal yellow homolog(mouse)), RNA-binding protein (autoantigenic), RNA-binding protein Raly
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RALY
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: RLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKIKLKSSELQAIK
• Quantity: 25ul
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 22913
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only