RAMP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25810425UL

Catalog No. NB435329

Description

RAMP2 Polyclonal specifically detects RAMP2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RAMP2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: calcitonin receptor-like receptor activity modifying protein 2, Calcitonin-receptor-like receptor activity-modifying protein 2, CRLR activity-modifying protein 2, receptor (calcitonin) activity modifying protein 2, receptor (G protein-coupled) activity modifying protein 2, receptor activity modifying protein 2, receptor activity-modifying protein 2, receptor-activity-modifying protein 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10266
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RAMP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only