Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RAP1B Antibody, Novus Biologicals™

RAP1B Antibody, Novus Biologicals™
SDP

Catalog No. NBP154871 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP154871 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP154871 Supplier Novus Biologicals Supplier No. NBP154871
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RAP1B Polyclonal specifically detects RAP1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen RAP1B
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P61224
Gene Alias DKFZp586H0723, GTP-binding protein smg p21B, K-REV, RAL1B, RAP1B, member of RAS oncogene family, Ras family small GTP binding protein RAP1B, ras-related protein Rap-1b, RAS-related protein RAP1B, small GTP binding protein
Gene Symbols RAP1B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RAP1B(RAP1B, member of RAS oncogene family) The peptide sequence was selected from the N terminal of RAP1B. Peptide sequence MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQ.
Molecular Weight of Antigen 21 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Endosome Markers, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5908
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.