RAPGEF5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23883525UL

Catalog No. NB396647

Description

RAPGEF5 Polyclonal specifically detects RAPGEF5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RAPGEF5
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q92565
• Gene Symbols: RAPGEF5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EEDLALVAITFSGEKHELQPNDLVISKSLEASGRIYVYRKDLADTLNPFAENEESQQRSMRILGMNTWDL
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 9771
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: GFRREPAC, Guanine nucleotide exchange factor for Rap1, KIAA0277M-Ras-regulated GEF, M-Ras-regulated Rap GEF, MRGEF, MR-GEFrap guanine nucleotide exchange factor 5, Rap guanine nucleotide exchange factor (GEF) 5, Related to Epac, Repac
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.