Rapsyn Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18553725UL

Catalog No. NB406520

Description

Rapsyn Polyclonal specifically detects Rapsyn in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Rapsyn
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: 43 kDa postsynaptic protein, Acetylcholine receptor-associated 43 kDa protein, CMS1D43 kDa receptor-associated protein of the synapse, CMS1EMGC3597, RAPsyn, receptor-associated protein of the synapse, receptor-associated protein of the synapse, 43kD, RNF205RING finger protein 205
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: RAPSN
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MECCEESMKIALQHGDRPLQALCLLCFADIHRSRGDLETAFPRYDSAMSIMTEIGNRLGQVQALLGVAKCWVARKALDKALDAIE
• Quantity: 25 μL
• Research Discipline: Neuroscience, Zinc Finger
• Gene ID (Entrez): 5913
• Target Species: Human
• Isotype: IgG

For Research Use Only