Ras-GAP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174143

Catalog No. NBP174143

Description

Ras-GAP Polyclonal specifically detects Ras-GAP in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: RAS p21
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CMAVM, DKFZp434N071, GAPp120GAPCM-AVM, GTPase-activating protein, p120RASGAP, PKWS, ras GTPase-activating protein 1, Ras p21 protein activator, RAS p21 protein activator (GTPase activating protein) 1, RASA, RasGAP, triphosphatase-activating protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5921
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q91YX7
• Gene Symbols: RASA1
• Immunogen: Synthetic peptides corresponding to the C terminal of Rasa1. Immunizing peptide sequence SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG