Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Ras-GAP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RAS p21 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Ras-GAP Polyclonal specifically detects Ras-GAP in Mouse samples. It is validated for Western Blot.Specifications
RAS p21 | |
Polyclonal | |
Rabbit | |
Q91YX7 | |
5921 | |
Synthetic peptides corresponding to the C terminal of Rasa1. Immunizing peptide sequence SNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CMAVM, DKFZp434N071, GAPp120GAPCM-AVM, GTPase-activating protein, p120RASGAP, PKWS, ras GTPase-activating protein 1, Ras p21 protein activator, RAS p21 protein activator (GTPase activating protein) 1, RASA, RasGAP, triphosphatase-activating protein | |
RASA1 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title