RASL10A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158920

Catalog No. NBP158920

Description

RASL10A Polyclonal specifically detects RASL10A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RASL10A
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ras-like protein family member 10A, RAS-like, family 10, member A, RAS-related on chromosome 22, Ras-related protein on chromosome 22, RRP22Ras-like protein RRP22
• Host Species: Rabbit
• Molecular Weight of Antigen: 23 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10633
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q92737
• Gene Symbols: RASL10A
• Immunogen: Synthetic peptides corresponding to RASL10A(RAS-like, family 10, member A) The peptide sequence was selected from the N terminal of RASL10A (NP_006468). Peptide sequence PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 85%.
• Target Species: Human, Equine
• Isotype: IgG