Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RASL10A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | RASL10A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RASL10A Polyclonal specifically detects RASL10A in Human samples. It is validated for Western Blot.Specifications
| RASL10A | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| ras-like protein family member 10A, RAS-like, family 10, member A, RAS-related on chromosome 22, Ras-related protein on chromosome 22, RRP22Ras-like protein RRP22 | |
| RASL10A | |
| IgG | |
| 23 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q92737 | |
| 10633 | |
| Synthetic peptides corresponding to RASL10A(RAS-like, family 10, member A) The peptide sequence was selected from the N terminal of RASL10A (NP_006468). Peptide sequence PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title