RBED1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179821

Catalog No. NBP179821

Description

RBED1 Polyclonal specifically detects RBED1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RBED1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C330008I15Rik, ELMO domain-containing protein 3, ELMO/CED-12 domain containing 3, FLJ21977, FLJ35601, liver-specific organic anion transporter 3TM12, LST3, MGC111036, organic anion transporter LST-3b, RBED1, RBM29, RNA binding motif and ELMO domain 1, RNA binding motif and ELMO/CED-12 domain 1, RNA binding motif protein 29, RNA-binding motif and ELMO domain-containing protein 1, RNA-binding motif protein 29, RNA-binding protein 29
• Host Species: Rabbit
• Molecular Weight of Antigen: 44 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 84173
• Target Species: Human, Mouse, Rat, Porcine, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_115589
• Gene Symbols: ELMOD3
• Immunogen: Synthetic peptide directed towards the C terminal of human ELMOD3. Peptide sequence FRLSRHHIQQFPFCLMSVNITHIAIQALREECLSRECNRQQKVIPVVNSF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.