RBFOX3/NeuN Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP32139325UL

Catalog No. NB237983

Description

RBFOX3/NeuN Polyclonal antibody specifically detects RBFOX3/NeuN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: RBFOX3/NeuN
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuN antigen, neuronal nuclei, neuronal nuclei antigen, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3, RNA binding protein, fox-1 homolog 3
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS
• Quantity: 25 μg
• Research Discipline: DNA replication Transcription Translation and Splicing, Neuronal Cell Markers, Neuroscience
• Gene ID (Entrez): 146713
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified