Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBFOX3/NeuN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$330.00 - $547.00
Specifications
| Antigen | RBFOX3/NeuN |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
RBFOX3/NeuN Polyclonal antibody specifically detects RBFOX3/NeuN in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| RBFOX3/NeuN | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing, Neuronal Cell Markers, Neuroscience | |
| PBS, pH 7.2, 40% glycerol | |
| 146713 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| FLJ56884, FLJ58356, Fox-1 homolog C, FOX3, FOX-3, hexaribonucleotide binding protein 3, HRNBP3, NeuN, neuN antigen, neuronal nuclei, neuronal nuclei antigen, RBFOX3, RNA binding protein fox-1 homolog 3, RNA binding protein, fox-1 homolog (C. elegans) 3, RNA binding protein, fox-1 homolog 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: SNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGS | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title