RBMS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158232

Catalog No. NBP158232

Description

RBMS1 Polyclonal specifically detects RBMS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RBMS1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein 1, suppressor of cdc 2 (cdc13) with RNA binding motif 2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5937
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P29558-2
• Gene Symbols: RBMS1
• Immunogen: Synthetic peptides corresponding to RBMS1 (RNA binding motif, single stranded interacting protein 1) The peptide sequence was selected from the middle region of RBMS1. Peptide sequence GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Goat: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Xenopus: 92%; Chicken: 92%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Zebrafish
• Form: Purified