RBMS1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15823220UL

Catalog No. NBP15823220

Description

RBMS1 Polyclonal specifically detects RBMS1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RBMS1
• Classification: Polyclonal
• Dilution: Western Blot 1.25 ug/ml
• Gene Accession No.: P29558-2
• Gene Symbols: RBMS1
• Immunogen: Synthetic peptides corresponding to RBMS1 (RNA binding motif, single stranded interacting protein 1) The peptide sequence was selected from the middle region of RBMS1. Peptide sequence GVSAPTEPLLCKFADGGQKKRQNPNKYIPNGRPWHREGEAGMTLTYDPTT.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: chromosome 2 open reading frame 12, DKFZp564H0764, HCC-4, MGC15146, MGC3331, MGC97258, MGC97270, MGC97282, MGC99543, MSSP1, MSSP-1, MSSP-2, MSSP-3, RNA binding motif, single stranded interacting protein 1, SCR2MGC70597, single-stranded-interacting protein 1, suppressor of cdc 2 (cdc13) with RNA binding motif 2
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5937
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG