Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RBMS2 Antibody, Novus Biologicals™

RBMS2 Antibody, Novus Biologicals™
SDP

Catalog No. NB5727120UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB5727120UL 20 μL
NBP157271 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB5727120UL Supplier Novus Biologicals Supplier No. NBP15727120UL

Description

Rabbit Polyclonal Antibody

RBMS2 Polyclonal specifically detects RBMS2 in Human samples. It is validated for Western Blot.

Specifications

Antigen RBMS2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q15434
Gene Alias FLJ39093, FLJ40023, RNA binding motif, single stranded interacting protein 2, RNA-binding motif, single-stranded-interacting protein 2, SCR3FLJ43262, Suppressor of CDC2 with RNA-binding motif 3
Gene Symbols RBMS2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RBMS2(RNA binding motif, single stranded interacting protein 2) The peptide sequence was selected from the N terminal of RBMS2. Peptide sequence MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 5939
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.