Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RBMS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RBMS2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NB5727120UL
|
Novus Biologicals
NBP15727120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157271
|
Novus Biologicals
NBP157271 |
100 μL |
Each for $487.50
|
|
|||||
Description
RBMS2 Polyclonal specifically detects RBMS2 in Human samples. It is validated for Western Blot.Specifications
| RBMS2 | |
| Polyclonal | |
| Rabbit | |
| Q15434 | |
| 5939 | |
| Synthetic peptides corresponding to RBMS2(RNA binding motif, single stranded interacting protein 2) The peptide sequence was selected from the N terminal of RBMS2. Peptide sequence MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ39093, FLJ40023, RNA binding motif, single stranded interacting protein 2, RNA-binding motif, single-stranded-interacting protein 2, SCR3FLJ43262, Suppressor of CDC2 with RNA-binding motif 3 | |
| RBMS2 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title