RDH12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15801720UL

Catalog No. NBP15801720

Description

RDH12 Polyclonal specifically detects RDH12 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RDH12
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q96NR8
• Gene Symbols: RDH12
• Immunogen: Synthetic peptides corresponding to RDH12(retinol dehydrogenase 12 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the middle region of RDH12. Peptide sequence AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT.
• Quantity: 20 μL
• Research Discipline: Vision
• Gene ID (Entrez): 145226
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: All-trans and 9-cis retinol dehydrogenase, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ30273, LCA13retinol dehydrogenase 12, all-trans and 9-cis, LCA3, retinol dehydrogenase 12, retinol dehydrogenase 12 (all-trans and 9-cis), retinol dehydrogenase 12 (all-trans/9-cis/11-cis), SDR7C2, short chain dehydrogenase/reductase family 7C, member 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG