Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RDH12 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | RDH12 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15801720
|
Novus Biologicals
NBP15801720UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP158017
|
Novus Biologicals
NBP158017 |
100 μL |
Each for $487.50
|
|
|||||
Description
RDH12 Polyclonal specifically detects RDH12 in Human samples. It is validated for Western Blot.Specifications
| RDH12 | |
| Polyclonal | |
| Rabbit | |
| Vision | |
| All-trans and 9-cis retinol dehydrogenase, EC 1.1.1, EC 1.1.1.-, EC 1.1.1.100, FLJ30273, LCA13retinol dehydrogenase 12, all-trans and 9-cis, LCA3, retinol dehydrogenase 12, retinol dehydrogenase 12 (all-trans and 9-cis), retinol dehydrogenase 12 (all-trans/9-cis/11-cis), SDR7C2, short chain dehydrogenase/reductase family 7C, member 2 | |
| RDH12 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q96NR8 | |
| 145226 | |
| Synthetic peptides corresponding to RDH12(retinol dehydrogenase 12 (all-trans/9-cis/11-cis)) The peptide sequence was selected from the middle region of RDH12. Peptide sequence AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title