RDH14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231647

Catalog No. NBP231647

Description

RDH14 Polyclonal specifically detects RDH14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RDH14
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9HBH5
• Gene Symbols: RDH14
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QTSIYLASSPEVEGVSGRYFGDCKEEELLPKAMDESVARKLWDISEVMVGL
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Alcohol dehydrogenase PAN2, EC 1.1.1.-, PAN2retinol dehydrogenase 14, pancreas protein 2, retinol dehydrogenase 14 (all-trans and 9-cis), retinol dehydrogenase 14 (all-trans/9-cis/11-cis), SDR7C4, short chain dehydrogenase/reductase family 7C, member 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57665
• Target Species: Human
• Isotype: IgG

For Research Use Only