Learn More
Description
Specifications
Specifications
| Antigen | REC8 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | Cohesin Rec8p, cohesion rec8p, HR21spB, meiotic recombination and sister chromatid cohesion phosphoprotein of therad21p family, meiotic recombination protein REC8 homolog, meiotic recombination protein REC8-like 1, MGC950, REC8 homolog (yeast), REC8L1human homolog of rad21, S. pombe, REC8-like 1, REC8-like 1 (yeast), Rec8p, recombination and sister chromatid cohesion protein homolog |
| Gene Symbols | REC8 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:PSPFDIPQIRHLLEAAIPERVEEIPPEVPTEPREPERIPVTVLPPEAITILEAEPIRMLEIEGERELPEVSRRELDLLI |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
