RECK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257738

Catalog No. NBP257738

Description

RECK Polyclonal specifically detects RECK in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RECK
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: hRECK, membrane-anchored glycoprotein (metastasis and invasion), reversion-inducing-cysteine-rich protein with kazal motifs, ST15reversion-inducing cysteine-rich protein with Kazal motifs, suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein withkazal motifs), suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein withkazal motifs), Suppressor of tumorigenicity 15 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RECK
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 8434
• Target Species: Human
• Isotype: IgG

For Research Use Only