Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157558

RED2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157558 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157558 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157558 Supplier Novus Biologicals Supplier No. NBP157558
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

RED2 Polyclonal specifically detects RED2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

Antigen RED2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9NS39
Gene Alias ADAR3adenosine deaminase, RNA-specific, B2 (RED1 homolog rat), adenosine deaminase, RNA-specific, B2, adenosine deaminase, RNA-specific, B2 (RED2 homolog rat), double-stranded RNA-specific editase B2, dsRNA adenosine deaminase B2, EC 3.5, EC 3.5.1.2, EC 3.5.4, FLJ25034, homolog of rat BLUE, hRED2, RED2 homolog, RED2FLJ36975, RNA-dependent adenosine deaminase 3, RNA-editing deaminase 2, RNA-editing enzyme 2
Gene Symbols ADARB2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ADARB2(adenosine deaminase, RNA-specific, B2 (RED2 homolog rat)) The peptide sequence was selected from the middle region of ADARB2 (NP_061172). Peptide sequence: SYRHNRPLLSGVSDAEARQPGKSPPFSMNWVVGSADLEIINATTGRRSCG.
Molecular Weight of Antigen 80 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 105
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Chicken: 85%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.