Reduced Folate Carrier/SLC19A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309929100UL

Catalog No. NB124759

Description

Reduced Folate Carrier/SLC19A1 Polyclonal specifically detects Reduced Folate Carrier/SLC19A1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Reduced Folate Carrier/SLC19A1
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CHMD, FLOT1, folate transporter 1, FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1, IFC1, IFC-1, Placental folate transporter, Reduced folate carrier protein, REFC, RFC, RFC1, solute carrier family 19 (folate transporter), member 1, Solute carrier family 19 member 1
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human Reduced Folate Carrier/SLC19A1 (XP_005261220). Peptide sequence SWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITPVLS
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6573
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.