Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Reduced Folate Carrier/SLC19A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Reduced Folate Carrier/SLC19A1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Reduced Folate Carrier/SLC19A1 Polyclonal specifically detects Reduced Folate Carrier/SLC19A1 in Human samples. It is validated for Western Blot.Specifications
| Reduced Folate Carrier/SLC19A1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CHMD, FLOT1, folate transporter 1, FOLThuman reduced folate carrier (RFC)10Intestinal folate carrier 1, IFC1, IFC-1, Placental folate transporter, Reduced folate carrier protein, REFC, RFC, RFC1, solute carrier family 19 (folate transporter), member 1, Solute carrier family 19 member 1 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Human Reduced Folate Carrier/SLC19A1 (XP_005261220). Peptide sequence SWRHLVCYLCFYGFMAQIRPGESFITPYLLGPDKNFTREQVTNEITPVLS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 6573 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title