Learn More
Description
Specifications
Specifications
| Antigen | RELM beta |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 2, CCRG, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, cysteine-rich secreted A12-alpha-like protein 1, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, FIZZ1, FIZZ2RELM-beta, found in inflammatory zone 1, HXCP2XCP2, RELMb, RELMbeta, resistin like beta, resistin-like beta, RETNL2 |
| Gene Symbols | RETNLB |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
