RELM beta Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB438656	Novus Biologicals NBP21321825UL	25ul
NBP213218	Novus Biologicals NBP213218	0.1 mL

Description

RELM beta Polyclonal specifically detects RELM beta in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RELM beta
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich proteinprecursor 2, CCRG, Colon and small intestine-specific cysteine-rich protein, Colon carcinoma-related gene protein, cysteine-rich secreted A12-alpha-like protein 1, Cysteine-rich secreted protein A12-alpha-like 1, Cysteine-rich secreted protein FIZZ2, FIZZ1, FIZZ2RELM-beta, found in inflammatory zone 1, HXCP2XCP2, RELMb, RELMbeta, resistin like beta, resistin-like beta, RETNL2
• Gene Symbols: RETNLB
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 84666
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only