Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Renin R Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 7 publications
$670.00
Specifications
| Antigen | Renin R |
|---|---|
| Dilution | Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Renin R Polyclonal specifically detects Renin R in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| Renin R | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), KnockDown | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10159 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:NSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50, Knockdown Validated | |
| Polyclonal | |
| Rabbit | |
| Human, Mouse, Rat | |
| APT6M8-9, ATP6M8-9MRXE, ATPase H(+)-transporting lysosomal accessory protein 2, ATPase H(+)-transporting lysosomal-interacting protein 2, ATPase, H+ transporting, lysosomal accessory protein 2, ATPase, H+ transporting, lysosomal interacting protein 2, CAPER, ELDF10, Embryonic liver differentiation factor 10, ER-localized type I transmembrane adaptor, H+ transporting, lysosomal (vacuolar proton pump) membrane sectorassociated protein M8-9, M8-9, MGC99577, MSTP009, N14F, renin receptor, vacuolar proton ATP synthase membrane sector associated protein M8-9, V-ATPase M8.9 subunit, XMRE | |
| ATP6AP2 | |
| IgG | |
| Affinity Purified | |
| Specificity of human Renin R antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title