RENT1/UPF1/hUPF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18964125UL

Catalog No. NB405877

Description

RENT1/UPF1/hUPF1 Polyclonal specifically detects RENT1/UPF1/hUPF1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

• Antigen: RENT1/UPF1/hUPF1
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200, Knockdown Validated
• Gene Alias: ATP-dependent helicase RENT1, EC 3.6.1, EC 3.6.4.-, FLJ43809, HUPF1, KIAA0221FLJ46894, Nonsense mRNA reducing factor 1, NORF1delta helicase, pNORF1, regulator of nonsense transcripts 1, RENT1UP Frameshift 1, UPF1 regulator of nonsense transcripts homolog (yeast), up-frameshift mutation 1 homolog, Up-frameshift suppressor 1 homolog, yeast Upf1p homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human RENT1/UPF1/hUPF1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: UPF1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LEELWKENPSATLEDLEKPGVDEEPQHVLLRYEDAYQYQNIFGPLVKLEADYDKKLKESQTQDNITVRWDLGLNKKRIAYFTLPKTD
• Quantity: 25 μL
• Research Discipline: DNA Repair, Transcription Factors and Regulators
• Gene ID (Entrez): 5976
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only