Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Reticulon 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	Reticulon 2
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15966220 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15966220UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159662 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159662	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Reticulon 2 Polyclonal specifically detects Reticulon 2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Reticulon 2
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	A8K7F2
Gene ID (Entrez)	6253
Immunogen	Synthetic peptides corresponding to RTN2(reticulon 2) The peptide sequence was selected from the N terminal of RTN2. Peptide sequence MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE.
Primary or Secondary	Primary
Molecular Weight of Antigen	51 kDa

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Neuroscience
Gene Alias	Neuroendocrine-specific protein-like 1, Neuroendocrine-specific protein-like I, NSP2, NSPL1NSP-like protein 1, NSPLI, NSP-like protein I, reticulon 2, reticulon-2
Gene Symbols	RTN2
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Reticulon 2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents