REXO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18486325UL

Catalog No. NB406833

Description

REXO1 Polyclonal specifically detects REXO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: REXO1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: EC 3.1, ELOABP1elongin A-binding protein 1, EloA-BP1REX1, Elongin-A-binding protein 1, KIAA1138elongin A binding protein 1, REX1, RNA exonuclease 1 homolog (S. cerevisiae), TCEB3BP1RNA exonuclease 1 homolog, transcription elongation factor B polypeptide 3 binding protein 1, Transcription elongation factor B polypeptide 3-binding protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: REXO1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT
• Quantity: 25ul
• Research Discipline: DNA Repair, Editing and Processing Endonucleases
• Gene ID (Entrez): 57455
• Target Species: Human
• Isotype: IgG

For Research Use Only