REXO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB406833	Novus Biologicals NBP18486325UL	25ul
NBP184863	Novus Biologicals NBP184863	0.1 mL

Description

REXO1 Polyclonal specifically detects REXO1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: REXO1
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: EC 3.1, ELOABP1elongin A-binding protein 1, EloA-BP1REX1, Elongin-A-binding protein 1, KIAA1138elongin A binding protein 1, REX1, RNA exonuclease 1 homolog (S. cerevisiae), TCEB3BP1RNA exonuclease 1 homolog, transcription elongation factor B polypeptide 3 binding protein 1, Transcription elongation factor B polypeptide 3-binding protein 1
• Gene Symbols: REXO1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: DNA Repair, Editing and Processing Endonucleases
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 57455
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PSGKYVVDNSRPPTDLEYDPLSNYSARHLSRASSRDERAAKRPRGSRGSEPYTPAPKKLCDPFGSCDARFSDSEDEAATVPGNEPTT
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only