RFC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256364

Catalog No. NBP256364

Description

RFC1 Polyclonal specifically detects RFC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RFC1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1, MGC51786, MHC binding factor, beta, MHCBFB, PO-GA, RECC1, replication factor C (activator 1) 1 (145kD), replication factor C (activator 1) 1, 145kDa, Replication factor C 140 kDa subunit, Replication factor C large subunit, replication factor C subunit 1, replication factor C1, RFC, RF-C 140 kDa subunit, RFC140DNA-binding protein PO-GA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RFC1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, DNA Repair
• Gene ID (Entrez): 5981
• Target Species: Human
• Isotype: IgG

For Research Use Only