Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RFC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | RFC1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
RFC1 Polyclonal specifically detects RFC1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| RFC1 | |
| Polyclonal | |
| Rabbit | |
| Cell Cycle and Replication, DNA Repair | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 5981 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEII | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| A1, A1 140 kDa subunit, Activator 1 140 kDa subunit, Activator 1 large subunit, Activator 1 subunit 1, MGC51786, MHC binding factor, beta, MHCBFB, PO-GA, RECC1, replication factor C (activator 1) 1 (145kD), replication factor C (activator 1) 1, 145kDa, Replication factor C 140 kDa subunit, Replication factor C large subunit, replication factor C subunit 1, replication factor C1, RFC, RF-C 140 kDa subunit, RFC140DNA-binding protein PO-GA | |
| RFC1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title