Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RFT1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15829520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15829520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP15829520 Supplier Novus Biologicals Supplier No. NBP15829520UL

Rabbit Polyclonal Antibody

RFT1 Polyclonal specifically detects RFT1 in Human samples. It is validated for Western Blot.

Specifications

Antigen RFT1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96AA3
Gene Alias DKFZp667J092, FLJ25945, putative endoplasmic reticulum multispan transmembrane protein, requiring fifty three 1 homolog (S. cerevisiae), RFT1 homolog (S. cerevisiae), RFT1, requiring fifty three 1 homolog
Gene Symbols RFT1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RFT1(RFT1 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of RFT1. Peptide sequence GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDPNVVPHYATGV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 91869
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.