Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. RG9MTD1 Antibody, Novus Biologicals™

RG9MTD1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1573620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1573620 20 μL
NBP157361 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1573620 Supplier Novus Biologicals Supplier No. NBP15736120UL

Description

Rabbit Polyclonal Antibody

RG9MTD1 Polyclonal specifically detects RG9MTD1 in Human samples. It is validated for Western Blot.

Specifications

Antigen RG9MTD1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q7L0Y3
Gene Alias EC 2.1.1, EC 2.1.1.-, EC 2.1.1.36, FLJ20432, HBV pre-S2 trans-regulated protein 2, Mitochondrial RNase P protein 1, MRPP1mitochondrial ribonuclease P protein 1, NY-REN-49 antigen, Renal carcinoma antigen NY-REN-49, RNA (guanine-9-) methyltransferase domain containing 1, RNA (guanine-9-)-methyltransferase domain-containing protein 1
Gene Symbols TRMT10C
Host Species Rabbit
Immunogen Synthetic peptides corresponding to RG9MTD1 (RNA (guanine-9-) methyltransferase domain containing 1) The peptide sequence was selected from the middle region of RG9MTD1. Peptide sequence MKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELVKRYQE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54931
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.