Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15539620UL
Description
RGS10 Polyclonal specifically detects RGS10 in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry.Specifications
RGS10 | |
Polyclonal | |
Western Blot 1:100-1:2000, Flow Cytometry 1:10-1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q96GN0 | |
RGS10 | |
Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT. | |
Affinity Purified | |
RUO | |
6001 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
regulator of G-protein signaling 10, regulator of G-protein signalling 10 | |
Rabbit | |
21 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction