Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

RGS10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	RGS10
Applications	Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15539620 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15539620UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP155396 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP155396	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

RGS10 Polyclonal specifically detects RGS10 in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry.

Specifications

Antigen	RGS10
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q96GN0
Gene ID (Entrez)	6001
Immunogen	Synthetic peptides corresponding to RGS10 (regulator of G-protein signalling 10) The peptide sequence was selected from the middle region of RGS10. Peptide sequence DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT.
Primary or Secondary	Primary

Applications	Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	regulator of G-protein signaling 10, regulator of G-protein signalling 10
Gene Symbols	RGS10
Isotype	IgG
Molecular Weight of Antigen	21 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

RGS10 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents