RGS18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP276522

Catalog No. NBP276522

Description

RGS18 Polyclonal specifically detects RGS18 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RGS18
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
• Gene Alias: regulator of G-protein signaling 18, regulator of G-protein signalling 13, RGS13regulator of G-protein signalling 18
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 64407.0
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
• Gene Symbols: RGS18
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPTNLRRRSRSFTCNEFQDVQSDVAIW
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.