RGS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255551

Catalog No. NBP255551

Description

RGS2 Polyclonal specifically detects RGS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: RGS2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Cell growth-inhibiting gene 31 protein, G0 to G1 switch regulatory 8, 24kD, G0/G1 switch regulatory protein 8, G0S8cell growth-inhibiting protein 31, regulator of G-protein signaling 2, regulator of G-protein signaling 2, 24kDa, regulator of G-protein signalling 2, 24kD, regulator of G-protein signalling 2, 24kDa
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RGS2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDL
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication, Signal Transduction
• Gene ID (Entrez): 5997
• Target Species: Human
• Isotype: IgG

For Research Use Only