Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | RGS2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RGS2 Polyclonal specifically detects RGS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
RGS2 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5997 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
Cell growth-inhibiting gene 31 protein, G0 to G1 switch regulatory 8, 24kD, G0/G1 switch regulatory protein 8, G0S8cell growth-inhibiting protein 31, regulator of G-protein signaling 2, regulator of G-protein signaling 2, 24kDa, regulator of G-protein signalling 2, 24kD, regulator of G-protein signalling 2, 24kDa | |
RGS2 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title