RGS20 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154885

Catalog No. NBP154885

Description

RGS20 Polyclonal specifically detects RGS20 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: RGS20
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: G(z)GAP, Gz-GAP, Gz-selective GTPase-activating protein, regulator of G-protein signaling 20, Regulator of G-protein signaling Z1, regulator of G-protein signalling 20, Regulator of Gz-selective protein signaling 1, RGSZ1g(z)GAP, ZGAP1gz-GAP
• Host Species: Rabbit
• Molecular Weight of Antigen: 25 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 8601
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: O76081
• Gene Symbols: RGS20
• Immunogen: Synthetic peptide directed towards the middle region of human RGS20 (NP_003693). Peptide sequence NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG