RGS22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156546

Catalog No. NBP156546

Description

RGS22 Polyclonal specifically detects RGS22 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: RGS22
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp434I092, FLJ40080, FLJ75004, MGC102908, PRTD-NY2, regulator of G-protein signaling 22, regulator of G-protein signalling 22
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26166
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NE09
• Gene Symbols: RGS22
• Immunogen: Synthetic peptides corresponding to RGS22(regulator of G-protein signaling 22) The peptide sequence was selected from the N terminal of RGS22. Peptide sequence QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Equine: 92%; Pig: 78%.
• Target Species: Human, Rat, Pig, Bovine, Equine
• Isotype: IgG