Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
RGS22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | RGS22 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
RGS22 Polyclonal specifically detects RGS22 in Human samples. It is validated for Western Blot.Specifications
RGS22 | |
Polyclonal | |
Rabbit | |
Q8NE09 | |
26166 | |
Synthetic peptides corresponding to RGS22(regulator of G-protein signaling 22) The peptide sequence was selected from the N terminal of RGS22. Peptide sequence QTVSTFSLPCCVPYNKLKSPAISSVSENFIFDDGVHPRTKKDPSKTNKLI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DKFZp434I092, FLJ40080, FLJ75004, MGC102908, PRTD-NY2, regulator of G-protein signaling 22, regulator of G-protein signalling 22 | |
RGS22 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title